Lineage for d1rcd__ (1rcd -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151501Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 151502Protein (Apo)ferritin [47246] (4 species)
  7. 151503Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 151505Domain d1rcd__: 1rcd - [16687]

Details for d1rcd__

PDB Entry: 1rcd (more details), 2 Å

PDB Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5

SCOP Domain Sequences for d1rcd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcd__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeekeh
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg

SCOP Domain Coordinates for d1rcd__:

Click to download the PDB-style file with coordinates for d1rcd__.
(The format of our PDB-style files is described here.)

Timeline for d1rcd__: