Lineage for d2ovea_ (2ove A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1800199Protein automated matches [190163] (13 species)
    not a true protein
  7. 1800225Species Human (Homo sapiens) [TaxId:9606] [188452] (13 PDB entries)
  8. 1800229Domain d2ovea_: 2ove A: [166869]
    automated match to d1iw2a_

Details for d2ovea_

PDB Entry: 2ove (more details), 2 Å

PDB Description: crystal structure of recombinant human complement protein c8gamma
PDB Compounds: (A:) Complement component 8, gamma polypeptide

SCOPe Domain Sequences for d2ovea_:

Sequence, based on SEQRES records: (download)

>d2ovea_ b.60.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spistiqpkanfdaqqfagtwllvavgsaarflqeqghraeattlhvapqgtamavstfr
kldgicwqvrqlygdtgvlgrfllqargargavhvvvaetdyqsfavlyleragqlsvkl
yarslpvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

Sequence, based on observed residues (ATOM records): (download)

>d2ovea_ b.60.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spistiqpkanfdaqqfagtwllvavgsaaraeattlhvapqgtamavstfrkldgicwq
vrqlygdtgvlgrfllqargargavhvvvaetdyqsfavlyleragqlsvklyarslpvs
dsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

SCOPe Domain Coordinates for d2ovea_:

Click to download the PDB-style file with coordinates for d2ovea_.
(The format of our PDB-style files is described here.)

Timeline for d2ovea_: