SCOPe 2.07: Domain d2ov2c1: 2ov2 C:1-177

Lineage for d2ov2c1 (2ov2 C:1-177)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d2ov2c1: 2ov2 C:1-177 [166861]
   Other proteins in same PDB: d2ov2a2, d2ov2b2, d2ov2c2, d2ov2d2, d2ov2d3, d2ov2e2, d2ov2f2, d2ov2f3, d2ov2g2, d2ov2h2, d2ov2h3
   automated match to d2c2ha1
   complexed with cl, edo, gcp, mg

Details for d2ov2c1

PDB Entry: 2ov2, 2.1 Å

PDB Description: the crystal structure of the human rac3 in complex with the crib domain of human p21-activated kinase 4 (pak4)

PDB Compounds: (C:) ras-related c3 botulinum toxin substrate 3

SCOPe Domain Sequences for d2ov2c1:

Sequence; same for both SEQRES and ATOM records:

>d2ov2c1 c.37.1.8 (C:1-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

Timeline for d2ov2c1:

• d2ov2c1 first appeared in SCOPe 2.01, called d2ov2c_
  
• d2ov2c1 appears in SCOPe 2.06
  
• d2ov2c1 appears in the current release, SCOPe 2.08