Lineage for d1bg7a_ (1bg7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314153Protein (Apo)ferritin [47246] (8 species)
  7. 2314154Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (22 PDB entries)
  8. 2314160Domain d1bg7a_: 1bg7 A: [16686]
    complexed with ca

Details for d1bg7a_

PDB Entry: 1bg7 (more details), 1.85 Å

PDB Description: localized unfolding at the junction of three ferritin subunits. a mechanism for iron release?
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d1bg7a_:

Sequence, based on SEQRES records: (download)

>d1bg7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlhkvgsdk
vdphlcdfleteypeeqvksikqlgdyitnlkrlglpqngmgeylfdkhtmge

Sequence, based on observed residues (ATOM records): (download)

>d1bg7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlpeeqvks
ikqlgdyitnlkrlglpqngmgeylfdkhtmge

SCOPe Domain Coordinates for d1bg7a_:

Click to download the PDB-style file with coordinates for d1bg7a_.
(The format of our PDB-style files is described here.)

Timeline for d1bg7a_: