Lineage for d1bg7__ (1bg7 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2450Family a.25.1.1: Ferritin [47241] (4 proteins)
  6. 2451Protein (Apo)ferritin [47246] (3 species)
  7. 2452Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 2453Domain d1bg7__: 1bg7 - [16686]

Details for d1bg7__

PDB Entry: 1bg7 (more details), 1.85 Å

PDB Description: localized unfolding at the junction of three ferritin subunits. a mechanism for iron release?

SCOP Domain Sequences for d1bg7__:

Sequence, based on SEQRES records: (download)

>d1bg7__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlhkvgsdk
vdphlcdfleteypeeqvksikqlgdyitnlkrlglpqngmgeylfdkhtmge

Sequence, based on observed residues (ATOM records): (download)

>d1bg7__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlpeeqvks
ikqlgdyitnlkrlglpqngmgeylfdkhtmge

SCOP Domain Coordinates for d1bg7__:

Click to download the PDB-style file with coordinates for d1bg7__.
(The format of our PDB-style files is described here.)

Timeline for d1bg7__: