Lineage for d1bg7__ (1bg7 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (4 proteins) 
Protein (Apo)ferritin [47246] (3 species) 
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries) 
Domain d1bg7__: 1bg7 - [16686]
Details for d1bg7__
PDB Entry: 1bg7 (more details), 1.85 Å
PDB Description: localized unfolding at the junction of three ferritin subunits. a mechanism for iron release?
SCOP Domain Sequences for d1bg7__:
Sequence, based on SEQRES records: (download)
>d1bg7__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlhkvgsdk
vdphlcdfleteypeeqvksikqlgdyitnlkrlglpqngmgeylfdkhtmge
Sequence, based on observed residues (ATOM records): (download)
>d1bg7__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlpeeqvks
ikqlgdyitnlkrlglpqngmgeylfdkhtmge
SCOP Domain Coordinates for d1bg7__:
Click to download the PDB-style file with coordinates for d1bg7__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bg7__:
- d1bg7__ appears in SCOP 1.57
- d1bg7__ appears in the current release, SCOPe 2.07, called d1bg7a_
View in 3D