Lineage for d2ou1b_ (2ou1 B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2647063Fold h.6: Apolipoprotein A-II [82935] (1 superfamily)
    segmented tetrameric parallel coiled coil
  4. 2647064Superfamily h.6.1: Apolipoprotein A-II [82936] (1 family) (S)
  5. 2647065Family h.6.1.1: Apolipoprotein A-II [82937] (1 protein)
  6. 2647066Protein Apolipoprotein A-II [82938] (1 species)
  7. 2647067Species Human (Homo sapiens) [TaxId:9606] [82939] (3 PDB entries)
  8. 2647069Domain d2ou1b_: 2ou1 B: [166845]

Details for d2ou1b_

PDB Entry: 2ou1 (more details), 2 Å

PDB Description: structures of apolipoprotein a-ii and a lipid surrogate complex provide insights into apolipoprotein-lipid interactions
PDB Compounds: (B:) Apolipoprotein A-II

SCOPe Domain Sequences for d2ou1b_:

Sequence, based on SEQRES records: (download)

>d2ou1b_ h.6.1.1 (B:) Apolipoprotein A-II {Human (Homo sapiens) [TaxId: 9606]}
epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnf
lsyfvelgtqpat

Sequence, based on observed residues (ATOM records): (download)

>d2ou1b_ h.6.1.1 (B:) Apolipoprotein A-II {Human (Homo sapiens) [TaxId: 9606]}
epcvslvsqyqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnfls
yfvelgtqpat

SCOPe Domain Coordinates for d2ou1b_:

Click to download the PDB-style file with coordinates for d2ou1b_.
(The format of our PDB-style files is described here.)

Timeline for d2ou1b_: