SCOPe 2.03: Domain d2otea_: 2ote A:

Lineage for d2otea_ (2ote A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (17 species)
   not a true protein

7. Species Clavularia sp. [TaxId:86521] [188532] (3 PDB entries)

8. Domain d2otea_: 2ote A: [166842]
   automated match to d1mova_
   complexed with act

Details for d2otea_

PDB Entry: 2ote, 1.47 Å

PDB Description: crystal structure of a monomeric cyan fluorescent protein in the photobleached state

PDB Compounds: (A:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d2otea_:

Sequence; same for both SEQRES and ATOM records:

>d2otea_ d.22.1.0 (A:) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydiltnaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge
nfppngpvmqkktlkwepsteilyvrdgvlvgdikhkllleggghhrvdfktiyrakkav
klpdyhfvdhrieilnhdkdynkvtvyesavary

Timeline for d2otea_:

• d2otea_ first appeared in SCOPe 2.01
  
• d2otea_ appears in SCOPe 2.02
  
• d2otea_ appears in SCOPe 2.04
  
• d2otea_ appears in the current release, SCOPe 2.08