Lineage for d2otbb_ (2otb B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1022370Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1022371Protein automated matches [190526] (7 species)
    not a true protein
  7. 1022385Species Clavularia sp. [TaxId:86521] [188532] (3 PDB entries)
  8. 1022390Domain d2otbb_: 2otb B: [166841]
    automated match to d1mova_

Details for d2otbb_

PDB Entry: 2otb (more details), 1.79 Å

PDB Description: crystal structure of a monomeric cyan fluorescent protein in the fluorescent state
PDB Compounds: (B:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d2otbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otbb_ d.22.1.0 (B:) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydiltnaf
aygnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlk
genfppngpvmqkktlkwepsteilyvrdgvlvgdikhkllleggghhrvdfktiyrakk
avklpdyhfvdhrieilnhdkdynkvtvyesavary

SCOPe Domain Coordinates for d2otbb_:

Click to download the PDB-style file with coordinates for d2otbb_.
(The format of our PDB-style files is described here.)

Timeline for d2otbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2otba_