SCOPe 2.08: Domain d2otbb_: 2otb B:

Lineage for d2otbb_ (2otb B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries)

8. Domain d2otbb_: 2otb B: [166841]
   automated match to d1mova_

Details for d2otbb_

PDB Entry: 2otb, 1.79 Å

PDB Description: crystal structure of a monomeric cyan fluorescent protein in the fluorescent state

PDB Compounds: (B:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d2otbb_:

Sequence; same for both SEQRES and ATOM records:

>d2otbb_ d.22.1.0 (B:) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydiltnaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge
nfppngpvmqkktlkwepsteilyvrdgvlvgdikhkllleggghhrvdfktiyrakkav
klpdyhfvdhrieilnhdkdynkvtvyesavary

Timeline for d2otbb_:

• d2otbb_ first appeared in SCOPe 2.01
  
• d2otbb_ appears in SCOPe 2.07