![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (26 species) not a true protein |
![]() | Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries) |
![]() | Domain d2otba_: 2otb A: [166840] automated match to d1mova_ |
PDB Entry: 2otb (more details), 1.79 Å
SCOPe Domain Sequences for d2otba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otba_ d.22.1.0 (A:) automated matches {Clavularia sp. [TaxId: 86521]} gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydiltnaf xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge nfppngpvmqkktlkwepsteilyvrdgvlvgdikhkllleggghhrvdfktiyrakkav klpdyhfvdhrieilnhdkdynkvtvyesavary
Timeline for d2otba_: