Lineage for d2otba_ (2otb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940727Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries)
  8. 2940738Domain d2otba_: 2otb A: [166840]
    automated match to d1mova_

Details for d2otba_

PDB Entry: 2otb (more details), 1.79 Å

PDB Description: crystal structure of a monomeric cyan fluorescent protein in the fluorescent state
PDB Compounds: (A:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d2otba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otba_ d.22.1.0 (A:) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydiltnaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge
nfppngpvmqkktlkwepsteilyvrdgvlvgdikhkllleggghhrvdfktiyrakkav
klpdyhfvdhrieilnhdkdynkvtvyesavary

SCOPe Domain Coordinates for d2otba_:

Click to download the PDB-style file with coordinates for d2otba_.
(The format of our PDB-style files is described here.)

Timeline for d2otba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2otbb_