SCOPe 2.06: Domain d2osha_: 2osh A:

Lineage for d2osha_ (2osh A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Chinese cobra (Naja atra) [TaxId:8656] [187966] (1 PDB entry)

8. Domain d2osha_: 2osh A: [166838]
   automated match to d1a3da_

Details for d2osha_

PDB Entry: 2osh, 2.2 Å

PDB Description: crystal structure of natratoxin, a snake spla2 that blocks a-type k+ channel

PDB Compounds: (A:) Phospholipase A2 1

SCOPe Domain Sequences for d2osha_:

Sequence; same for both SEQRES and ATOM records:

>d2osha_ a.133.1.2 (A:) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
nlyqfknmiqctvpsrswcdfadygcycgkggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapytdanynidlkarcq

Timeline for d2osha_:

• d2osha_ first appeared in SCOPe 2.01
  
• d2osha_ appears in SCOPe 2.05
  
• d2osha_ appears in SCOPe 2.07
  
• d2osha_ appears in the current release, SCOPe 2.08