Class a: All alpha proteins [46456] (284 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) |
Protein automated matches [190139] (19 species) not a true protein |
Species Chinese cobra (Naja atra) [TaxId:8656] [187966] (1 PDB entry) |
Domain d2osha_: 2osh A: [166838] automated match to d1a3da_ |
PDB Entry: 2osh (more details), 2.2 Å
SCOPe Domain Sequences for d2osha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2osha_ a.133.1.2 (A:) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]} nlyqfknmiqctvpsrswcdfadygcycgkggsgtpvddldrccqvhdncyneaekisgc wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapytdanynidlkarcq
Timeline for d2osha_: