![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
![]() | Protein Peptide deformylase [56422] (11 species) |
![]() | Species Streptococcus pyogenes [TaxId:160490] [188359] (1 PDB entry) |
![]() | Domain d2os3a_: 2os3 A: [166836] automated match to d1lm6a_ complexed with bb2, co |
PDB Entry: 2os3 (more details), 2.26 Å
SCOPe Domain Sequences for d2os3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2os3a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pyogenes [TaxId: 160490]} saqdklikpshlitmddiiregnptlravakevslplcdedillgekmmqflkhsqdpvm aeklglragvglaapqidvskriiavlvpnlpdkegnppkeayswqevlynpkivshsvq daalsdgegclsvdrvvegyvvrharvtvdyydkegqqhriklkgynaivvqheidhing vlfydrinaknpfetkeellildle
Timeline for d2os3a_: