Lineage for d2oqdb_ (2oqd B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750608Protein automated matches [190139] (25 species)
    not a true protein
  7. 1750703Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (7 PDB entries)
  8. 1750715Domain d2oqdb_: 2oqd B: [166825]
    automated match to d1gmza_

Details for d2oqdb_

PDB Entry: 2oqd (more details), 2.19 Å

PDB Description: Crystal Structure of BthTX-II
PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d2oqdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqdb_ a.133.1.2 (B:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
dlwqfgqmilketgklpfpyyttygcycgwggqgqpkdatdrccfvhdccygkltnckpk
tdrysysrengviicgegtpcekqicecdkaaavcfrenlrtykkrymaypdvlckkpae
kc

SCOPe Domain Coordinates for d2oqdb_:

Click to download the PDB-style file with coordinates for d2oqdb_.
(The format of our PDB-style files is described here.)

Timeline for d2oqdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2oqda_