Lineage for d2opxa_ (2opx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909216Species Escherichia coli [TaxId:469008] [187964] (1 PDB entry)
  8. 2909217Domain d2opxa_: 2opx A: [166820]
    automated match to d1wnba_
    complexed with dxc

Details for d2opxa_

PDB Entry: 2opx (more details), 2.53 Å

PDB Description: Crystal Structure of Lactaldehyde Dehydrogenase from Escherichia coli
PDB Compounds: (A:) Aldehyde dehydrogenase A

SCOPe Domain Sequences for d2opxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opxa_ c.82.1.0 (A:) automated matches {Escherichia coli [TaxId: 469008]}
vpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpewea
lpaieraswlrkisagirerateisaliveeggkiqqlaevevaftadyidymaewarry
egeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpseftp
nnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimataa
knitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydqfv
nrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvalggkavegkg
yyypptllldvrqemsimheetfgpvlpvvafdtleeaismandsdygltssiytqnlnv
amkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs

SCOPe Domain Coordinates for d2opxa_:

Click to download the PDB-style file with coordinates for d2opxa_.
(The format of our PDB-style files is described here.)

Timeline for d2opxa_: