| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins) automatically mapped to Pfam PF01234 |
| Protein automated matches [190168] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186895] (34 PDB entries) |
| Domain d2opba_: 2opb A: [166815] automated match to d1hnnb_ complexed with f21, po4, sah |
PDB Entry: 2opb (more details), 2.8 Å
SCOPe Domain Sequences for d2opba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2opba_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asayqrfepraylrnnyapprgdlcnpngvgpwalrclaqtfatgevsgrtlidigsgpt
vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk
erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt
llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq
tgvddvkgvffawaqkv
Timeline for d2opba_: