SCOPe 2.08: Domain d2opab_: 2opa B:

Lineage for d2opab_ (2opa B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188341] (2 PDB entries)

8. Domain d2opab_: 2opa B: [166814]
   automated match to d1otfa_
   complexed with fhc

Details for d2opab_

PDB Entry: 2opa, 2.4 Å

PDB Description: ywhb binary complex with 2-fluoro-p-hydroxycinnamate

PDB Compounds: (B:) Probable tautomerase ywhB

SCOPe Domain Sequences for d2opab_:

Sequence; same for both SEQRES and ATOM records:

>d2opab_ d.80.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
pyvtvkmlegrtdeqkrnlvekvteavkettgaseekivvfieemrkdhyavagkrlsdm
e

Timeline for d2opab_:

• d2opab_ first appeared in SCOPe 2.01
  
• d2opab_ appears in SCOPe 2.07