SCOPe 2.08: Domain d2ooqb1: 2ooq B:890-1168

Lineage for d2ooqb1 (2ooq B:890-1168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)

8. Domain d2ooqb1: 2ooq B:890-1168 [166809]
   Other proteins in same PDB: d2ooqa2, d2ooqb2
   automated match to d1rpma_
   complexed with b3p, edo, na

Details for d2ooqb1

PDB Entry: 2ooq, 1.8 Å

PDB Description: crystal structure of the human receptor phosphatase ptprt

PDB Compounds: (B:) Receptor-type tyrosine-protein phosphatase T

SCOPe Domain Sequences for d2ooqb1:

Sequence; same for both SEQRES and ATOM records:

>d2ooqb1 c.45.1.2 (B:890-1168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
airvadllqhitqmkrgqgygfkeeyealpegqtaswdtakedenrnknrygniisydhs
rvrllvldgdphsdyinanyidgyhrprhyiatqgpmqetvkdfwrmiwqensasivmvt
nlvevgrvkcvrywpddtevygdikvtlieteplaeyvirtftvqkkgyheirelrlfhf
tswpdhgvpcyatgllgfvrqvkflnppeagpivvhcsagagrtgcfiaidtmldmaene
gvvdifncvrelraqrvnlvqteeqyvfvhdaileaclc

Timeline for d2ooqb1:

• d2ooqb1 first appeared in SCOPe 2.01, called d2ooqb_
  
• d2ooqb1 appears in SCOPe 2.07