SCOPe 2.05: Domain d2ooqa_: 2ooq A:

Lineage for d2ooqa_ (2ooq A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (22 PDB entries)

8. Domain d2ooqa_: 2ooq A: [166808]
   automated match to d1rpma_
   complexed with b3p, edo, na

Details for d2ooqa_

PDB Entry: 2ooq, 1.8 Å

PDB Description: crystal structure of the human receptor phosphatase ptprt

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase T

SCOPe Domain Sequences for d2ooqa_:

Sequence, based on SEQRES records:

>d2ooqa_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mairvadllqhitqmkrgqgygfkeeyealpegqtaswdtakedenrnknrygniisydh
srvrllvldgdphsdyinanyidgyhrprhyiatqgpmqetvkdfwrmiwqensasivmv
tnlvevgrvkcvrywpddtevygdikvtlieteplaeyvirtftvqkkgyheirelrlfh
ftswpdhgvpcyatgllgfvrqvkflnppeagpivvhcsagagrtgcfiaidtmldmaen
egvvdifncvrelraqrvnlvqteeqyvfvhdaileaclc

Sequence, based on observed residues (ATOM records):

>d2ooqa_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mairvadllqhitqmkrgqgygfkeeyealpegqtaswdtakedenrnknrygniisydh
srvrllvldphsdyinanyidgyhrprhyiatqgpmqetvkdfwrmiwqensasivmvtn
lvevgrvkcvrywpddtevygdikvtlieteplaeyvirtftvqkkgyheirelrlfhft
swpdhgvpcyatgllgfvrqvkflnppeagpivvhcsagagrtgcfiaidtmldmaeneg
vvdifncvrelraqrvnlvqteeqyvfvhdaileaclc

Timeline for d2ooqa_:

• d2ooqa_ first appeared in SCOPe 2.01
  
• d2ooqa_ appears in SCOPe 2.04
  
• d2ooqa_ is called d2ooqa1 in SCOPe 2.06
  
• d2ooqa_ appears in the current release, SCOPe 2.08, called d2ooqa1