SCOPe 2.03: Domain d2onza_: 2onz A:

Lineage for d2onza_ (2onz A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
   automatically mapped to Pfam PF01234

6. Protein automated matches [190168] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186895] (31 PDB entries)

8. Domain d2onza_: 2onz A: [166805]
   automated match to d1hnnb_
   complexed with sah, tmj

Details for d2onza_

PDB Entry: 2onz, 2.8 Å

PDB Description: structure of k57a hpnmt with inhibitor 7-(n-4- chlorophenylaminosulfonyl)-thiq and adohcy

PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d2onza_:

Sequence; same for both SEQRES and ATOM records:

>d2onza_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asayqrfepraylrnnyapprgdlcnpngvgpwalrclaqtfatgevsgrtlidigsgpt
vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk
erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt
llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq
tgvddvkgvffawaqkv

Timeline for d2onza_:

• d2onza_ first appeared in SCOPe 2.01
  
• d2onza_ appears in SCOPe 2.02
  
• d2onza_ appears in SCOPe 2.04
  
• d2onza_ appears in the current release, SCOPe 2.08