![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (3 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (7 proteins) |
![]() | Protein (Apo)ferritin [47246] (5 species) |
![]() | Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (6 PDB entries) |
![]() | Domain d1iesa_: 1ies A: [16679] |
PDB Entry: 1ies (more details), 2.5 Å
SCOP Domain Sequences for d1iesa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iesa_ a.25.1.1 (A:) (Apo)ferritin {Horse (Equus caballus), L chain} ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre gaerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaq adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
Timeline for d1iesa_: