Lineage for d1dat__ (1dat -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441062Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 441063Protein (Apo)ferritin [47246] (5 species)
  7. 441095Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (6 PDB entries)
  8. 441098Domain d1dat__: 1dat - [16677]

Details for d1dat__

PDB Entry: 1dat (more details), 2.05 Å

PDB Description: cubic crystal structure recombinant horse l apoferritin

SCOP Domain Sequences for d1dat__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dat__ a.25.1.1 (-) (Apo)ferritin {Horse (Equus caballus), L chain}
ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre
gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd

SCOP Domain Coordinates for d1dat__:

Click to download the PDB-style file with coordinates for d1dat__.
(The format of our PDB-style files is described here.)

Timeline for d1dat__: