Lineage for d1dat__ (1dat -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (5 proteins) Protein (Apo)ferritin [47246] (4 species) 
Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (5 PDB entries) 
Domain d1dat__: 1dat - [16677]
Details for d1dat__
PDB Entry: 1dat (more details), 2.05 Å
PDB Description: cubic crystal structure recombinant horse l apoferritin
SCOP Domain Sequences for d1dat__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dat__ a.25.1.1 (-) (Apo)ferritin {Horse (Equus caballus), L chain}
ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre
gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
SCOP Domain Coordinates for d1dat__:
Click to download the PDB-style file with coordinates for d1dat__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dat__:
- d1dat__ first appeared (with stable ids) in SCOP 1.55
- d1dat__ appears in SCOP 1.59
- d1dat__ appears in the current release, SCOPe 2.08, called d1data_
View in 3D