SCOPe 2.05: Domain d2ol8o_: 2ol8 O:

Lineage for d2ol8o_ (2ol8 O:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.1: Outer surface protein [51087] (1 family)
   21 stranded sheet partly folded upon itself at the ends

5. Family b.76.1.1: Outer surface protein [51088] (3 proteins)

6. Protein automated matches [190440] (1 species)
   not a true protein

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (13 PDB entries)

8. Domain d2ol8o_: 2ol8 O: [166762]
   automated match to d1fj1e_
   mutant

Details for d2ol8o_

PDB Entry: 2ol8, 1.9 Å

PDB Description: the crystal structure of ospa mutant

PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d2ol8o_:

Sequence; same for both SEQRES and ATOM records:

>d2ol8o_ b.76.1.1 (O:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskkvtsngssteekiidgiiiekiitradgtrleytg
iksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsvelndtdssaa
tkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitkldeik
nalk

Timeline for d2ol8o_:

• d2ol8o_ first appeared in SCOPe 2.01
  
• d2ol8o_ appears in SCOPe 2.04
  
• d2ol8o_ appears in SCOPe 2.06
  
• d2ol8o_ appears in the current release, SCOPe 2.08