Lineage for d1aew__ (1aew -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 353828Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 353829Protein (Apo)ferritin [47246] (4 species)
  7. 353861Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (6 PDB entries)
  8. 353863Domain d1aew__: 1aew - [16676]
    complexed with cd

Details for d1aew__

PDB Entry: 1aew (more details), 1.95 Å

PDB Description: l-chain horse apoferritin

SCOP Domain Sequences for d1aew__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aew__ a.25.1.1 (-) (Apo)ferritin {Horse (Equus caballus), L chain}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

SCOP Domain Coordinates for d1aew__:

Click to download the PDB-style file with coordinates for d1aew__.
(The format of our PDB-style files is described here.)

Timeline for d1aew__: