SCOP 1.65: Domain d1aew__: 1aew -

Lineage for d1aew__ (1aew -)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)
   contains dimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein (Apo)ferritin [47246] (4 species)

7. Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (6 PDB entries)

8. Domain d1aew__: 1aew - [16676]
   complexed with cd

Details for d1aew__

PDB Entry: 1aew, 1.95 Å

PDB Description: l-chain horse apoferritin

SCOP Domain Sequences for d1aew__:

Sequence; same for both SEQRES and ATOM records:

>d1aew__ a.25.1.1 (-) (Apo)ferritin {Horse (Equus caballus), L chain}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

Timeline for d1aew__:

• d1aew__ first appeared (with stable ids) in SCOP 1.55
  
• d1aew__ appears in SCOP 1.63
  
• d1aew__ appears in SCOP 1.67
  
• d1aew__ appears in the current release, SCOPe 2.08, called d1aewa_