SCOPe 2.06: Domain d2ol1a_: 2ol1 A:

Lineage for d2ol1a_ (2ol1 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Vaccinia virus [TaxId:10245] [187961] (5 PDB entries)

8. Domain d2ol1a_: 2ol1 A: [166756]
   automated match to d1q5hb_
   complexed with cl, edo, ump

Details for d2ol1a_

PDB Entry: 2ol1, 1.8 Å

PDB Description: high resolution crystal structures of vaccinia virus dutpase

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2ol1a_:

Sequence; same for both SEQRES and ATOM records:

>d2ol1a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Vaccinia virus [TaxId: 10245]}
spvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygria
prsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypelee
vqsl

Timeline for d2ol1a_:

• d2ol1a_ first appeared in SCOPe 2.01
  
• d2ol1a_ appears in SCOPe 2.05
  
• d2ol1a_ appears in SCOPe 2.07
  
• d2ol1a_ appears in the current release, SCOPe 2.08