SCOPe 2.04: Domain d2ol0b_: 2ol0 B:

Lineage for d2ol0b_ (2ol0 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Vaccinia virus [TaxId:10245] [187961] (5 PDB entries)

8. Domain d2ol0b_: 2ol0 B: [166754]
   automated match to d1q5hb_
   complexed with cl, dud, edo, mg

Details for d2ol0b_

PDB Entry: 2ol0, 2.1 Å

PDB Description: high resolution crystal structures of vaccinia virus dutpase

PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2ol0b_:

Sequence; same for both SEQRES and ATOM records:

>d2ol0b_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Vaccinia virus [TaxId: 10245]}
spvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygria
prsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypelee
vqsl

Timeline for d2ol0b_:

• d2ol0b_ first appeared in SCOPe 2.01
  
• d2ol0b_ appears in SCOPe 2.03
  
• d2ol0b_ appears in SCOPe 2.05
  
• d2ol0b_ appears in the current release, SCOPe 2.08