SCOP 1.61: Domain d1fha__: 1fha -

Lineage for d1fha__ (1fha -)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein (Apo)ferritin [47246] (4 species)

7. Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (2 PDB entries)

8. Domain d1fha__: 1fha - [16675]

Details for d1fha__

PDB Entry: 1fha, 2.4 Å

PDB Description: solving the structure of human h ferritin by genetically engineering intermolecular crystal contacts

SCOP Domain Sequences for d1fha__:

Sequence; same for both SEQRES and ATOM records:

>d1fha__ a.25.1.1 (-) (Apo)ferritin {Human (Homo sapiens), H chain}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d1fha__:

• d1fha__ first appeared (with stable ids) in SCOP 1.55
  
• d1fha__ appears in SCOP 1.59
  
• d1fha__ appears in SCOP 1.63
  
• d1fha__ appears in the current release, SCOPe 2.08, called d1fhaa_