Lineage for d1fha__ (1fha -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (5 proteins) Protein (Apo)ferritin [47246] (4 species) 
Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (2 PDB entries) 
Domain d1fha__: 1fha - [16675]
Details for d1fha__
PDB Entry: 1fha (more details), 2.4 Å
PDB Description: solving the structure of human h ferritin by genetically engineering intermolecular crystal contacts
SCOP Domain Sequences for d1fha__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fha__ a.25.1.1 (-) (Apo)ferritin {Human (Homo sapiens), H chain}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
SCOP Domain Coordinates for d1fha__:
Click to download the PDB-style file with coordinates for d1fha__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fha__:
- d1fha__ first appeared (with stable ids) in SCOP 1.55
- d1fha__ appears in SCOP 1.59
- d1fha__ appears in the current release, SCOPe 2.08, called d1fhaa_
View in 3D