SCOPe 2.08: Domain d1fhaa_: 1fha A:

Lineage for d1fhaa_ (1fha A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein (Apo)ferritin [47246] (8 species)

7. Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (46 PDB entries)

8. Domain d1fhaa_: 1fha A: [16675]
   complexed with ca, fe

Details for d1fhaa_

PDB Entry: 1fha, 2.4 Å

PDB Description: solving the structure of human h ferritin by genetically engineering intermolecular crystal contacts

PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d1fhaa_:

Sequence; same for both SEQRES and ATOM records:

>d1fhaa_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d1fhaa_:

• d1fhaa_ first appeared (with stable ids) in SCOP 1.55, called d1fha__
  
• d1fhaa_ appears in SCOPe 2.07