Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
Protein automated matches [190503] (10 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [188324] (1 PDB entry) |
Domain d2okma_: 2okm A: [166743] automated match to d1amxa_ complexed with so4 |
PDB Entry: 2okm (more details), 1.65 Å
SCOPe Domain Sequences for d2okma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2okma_ b.2.3.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]} erdypffykvgdlagesnqvrwflnvnlnksdvtedisiadrqgsgqqlnkesftfdivn dketkyislaefeqqgygkidfvtdndfnlrfyrdkarftsfivrytstiteagqhqatf ensydinyqlnnqdatnekntsqvkn
Timeline for d2okma_: