Lineage for d2okma_ (2okm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767847Species Enterococcus faecalis [TaxId:1351] [188324] (1 PDB entry)
  8. 2767848Domain d2okma_: 2okm A: [166743]
    automated match to d1amxa_
    complexed with so4

Details for d2okma_

PDB Entry: 2okm (more details), 1.65 Å

PDB Description: Crystal structure of ACE19, the collagen binding subdomain of Enterococcus faecalis surface protein ACE
PDB Compounds: (A:) collagen adhesin

SCOPe Domain Sequences for d2okma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2okma_ b.2.3.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
erdypffykvgdlagesnqvrwflnvnlnksdvtedisiadrqgsgqqlnkesftfdivn
dketkyislaefeqqgygkidfvtdndfnlrfyrdkarftsfivrytstiteagqhqatf
ensydinyqlnnqdatnekntsqvkn

SCOPe Domain Coordinates for d2okma_:

Click to download the PDB-style file with coordinates for d2okma_.
(The format of our PDB-style files is described here.)

Timeline for d2okma_: