Lineage for d2fha__ (2fha -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96482Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 96483Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 96484Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 96485Protein (Apo)ferritin [47246] (4 species)
  7. 96528Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (2 PDB entries)
  8. 96529Domain d2fha__: 2fha - [16674]

Details for d2fha__

PDB Entry: 2fha (more details), 1.9 Å

PDB Description: human h chain ferritin

SCOP Domain Sequences for d2fha__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fha__ a.25.1.1 (-) (Apo)ferritin {Human (Homo sapiens), H chain}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOP Domain Coordinates for d2fha__:

Click to download the PDB-style file with coordinates for d2fha__.
(The format of our PDB-style files is described here.)

Timeline for d2fha__: