Lineage for d2fha__ (2fha -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (5 proteins) Protein (Apo)ferritin [47246] (4 species) 
Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (2 PDB entries) 
Domain d2fha__: 2fha - [16674]
Details for d2fha__
PDB Entry: 2fha (more details), 1.9 Å
PDB Description: human h chain ferritin
SCOP Domain Sequences for d2fha__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fha__ a.25.1.1 (-) (Apo)ferritin {Human (Homo sapiens), H chain}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
SCOP Domain Coordinates for d2fha__:
Click to download the PDB-style file with coordinates for d2fha__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fha__:
- d2fha__ first appeared (with stable ids) in SCOP 1.55
- d2fha__ appears in SCOP 1.59
- d2fha__ appears in the current release, SCOPe 2.08, called d2fhaa_
View in 3D