| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein (Apo)ferritin [47246] (8 species) |
| Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (46 PDB entries) |
| Domain d2fhaa_: 2fha A: [16674] complexed with ca |
PDB Entry: 2fha (more details), 1.9 Å
SCOPe Domain Sequences for d2fhaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhaa_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
Timeline for d2fhaa_: