Lineage for d2okdb_ (2okd B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083305Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2083375Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2083437Species Vaccinia virus [TaxId:10245] [187961] (5 PDB entries)
  8. 2083448Domain d2okdb_: 2okd B: [166736]
    automated match to d1q5hb_
    complexed with cl, edo

Details for d2okdb_

PDB Entry: 2okd (more details), 2.4 Å

PDB Description: High Resolution Crystal Structures of Vaccinia Virus dUTPase
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2okdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2okdb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Vaccinia virus [TaxId: 10245]}
pvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriap
rsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypeleev
qsl

SCOPe Domain Coordinates for d2okdb_:

Click to download the PDB-style file with coordinates for d2okdb_.
(The format of our PDB-style files is described here.)

Timeline for d2okdb_: