SCOPe 2.02: Domain d2okbb_: 2okb B:

Lineage for d2okbb_ (2okb B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Vaccinia virus [TaxId:10245] [187961] (5 PDB entries)

8. Domain d2okbb_: 2okb B: [166733]
   automated match to d1q5hb_
   complexed with cl, edo, so4

Details for d2okbb_

PDB Entry: 2okb, 2.15 Å

PDB Description: high resolution crystal structures of vaccinia virus dutpase

PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2okbb_:

Sequence; same for both SEQRES and ATOM records:

>d2okbb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Vaccinia virus [TaxId: 10245]}
mfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriaprs
glslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyyp

Timeline for d2okbb_:

• d2okbb_ first appeared in SCOPe 2.01
  
• d2okbb_ appears in SCOPe 2.03
  
• d2okbb_ appears in the current release, SCOPe 2.08