Lineage for d2okbb_ (2okb B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964543Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 964544Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 964595Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 964666Species Vaccinia virus [TaxId:10245] [187961] (5 PDB entries)
  8. 964674Domain d2okbb_: 2okb B: [166733]
    automated match to d1q5hb_
    complexed with cl, edo, so4

Details for d2okbb_

PDB Entry: 2okb (more details), 2.15 Å

PDB Description: high resolution crystal structures of vaccinia virus dutpase
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2okbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2okbb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Vaccinia virus [TaxId: 10245]}
mfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriaprs
glslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyyp

SCOPe Domain Coordinates for d2okbb_:

Click to download the PDB-style file with coordinates for d2okbb_.
(The format of our PDB-style files is described here.)

Timeline for d2okbb_: