SCOPe 2.06: Domain d2okab_: 2oka B:

Lineage for d2okab_ (2oka B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
   Pfam PF05169; "minimalized" version of the thioredoxin-like fold

6. Protein automated matches [190755] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187962] (1 PDB entry)

8. Domain d2okab_: 2oka B: [166729]
   automated match to d2fa8a1

Details for d2okab_

PDB Entry: 2oka, 2.5 Å

PDB Description: crystal structure of q9hyq7_pseae from pseudomonas aeruginosa. northeast structural genomics consortium target par82

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2okab_:

Sequence; same for both SEQRES and ATOM records:

>d2okab_ c.47.1.23 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
akpeivityctqcqwllraawlaqellstfaddlgkvclepgtggvfritcdgvqvwerk
adggfpeakalkqrvrdridpqrd

Timeline for d2okab_:

• d2okab_ first appeared in SCOPe 2.01
  
• d2okab_ appears in SCOPe 2.05
  
• d2okab_ appears in SCOPe 2.07
  
• d2okab_ appears in the current release, SCOPe 2.08