Lineage for d2okaa_ (2oka A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878927Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
    Pfam PF05169; "minimalized" version of the thioredoxin-like fold
  6. 2878940Protein automated matches [190755] (4 species)
    not a true protein
  7. 2878944Species Pseudomonas aeruginosa [TaxId:287] [187962] (1 PDB entry)
  8. 2878945Domain d2okaa_: 2oka A: [166728]
    automated match to d2fa8a1

Details for d2okaa_

PDB Entry: 2oka (more details), 2.5 Å

PDB Description: crystal structure of q9hyq7_pseae from pseudomonas aeruginosa. northeast structural genomics consortium target par82
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2okaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2okaa_ c.47.1.23 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
akpeivityctqcqwllraawlaqellstfaddlgkvclepgtggvfritcdgvqvwerk
adggfpeakalkqrvrdridpqrd

SCOPe Domain Coordinates for d2okaa_:

Click to download the PDB-style file with coordinates for d2okaa_.
(The format of our PDB-style files is described here.)

Timeline for d2okaa_: