SCOPe 2.03: Domain d2ok4h_: 2ok4 H:

Lineage for d2ok4h_ (2ok4 H:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.0: automated matches [191380] (1 protein)
   not a true family

6. Protein automated matches [190474] (1 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)

8. Domain d2ok4h_: 2ok4 H: [166723]
   automated match to d1mg2b_
   complexed with hy1

Details for d2ok4h_

PDB Entry: 2ok4, 1.45 Å

PDB Description: Crystal structure of aromatic amine dehydrogenase TTQ-phenylacetaldehyde adduct oxidized with ferricyanide

PDB Compounds: (H:) Aromatic amine dehydrogenase, small subunit

SCOPe Domain Sequences for d2ok4h_:

Sequence; same for both SEQRES and ATOM records:

>d2ok4h_ g.21.1.0 (H:) automated matches {Alcaligenes faecalis [TaxId: 511]}
hislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphd
gkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvg
la

Timeline for d2ok4h_:

• d2ok4h_ first appeared in SCOPe 2.01
  
• d2ok4h_ appears in SCOPe 2.02
  
• d2ok4h_ appears in SCOPe 2.04
  
• d2ok4h_ appears in the current release, SCOPe 2.08