Lineage for d2ojpa_ (2ojp A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1821801Protein Dihydrodipicolinate synthase [51574] (12 species)
  7. 1821831Species Escherichia coli [TaxId:562] [51575] (15 PDB entries)
  8. 1821842Domain d2ojpa_: 2ojp A: [166718]
    automated match to d1dhpa_
    complexed with gol; mutant

Details for d2ojpa_

PDB Entry: 2ojp (more details), 1.7 Å

PDB Description: the crystal structure of a dimeric mutant of dihydrodipicolinate synthase from e.coli- dhdps-l197y
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2ojpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojpa_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqygghgvisvtanvaardmaqmcklaaeghfaearvinerlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOPe Domain Coordinates for d2ojpa_:

Click to download the PDB-style file with coordinates for d2ojpa_.
(The format of our PDB-style files is described here.)

Timeline for d2ojpa_: