SCOPe 2.01: Domain d2ojla_: 2ojl A:

Lineage for d2ojla_ (2ojl A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
   Pfam PF05169; "minimalized" version of the thioredoxin-like fold

6. Protein automated matches [190755] (4 species)
   not a true protein

7. Species Bordetella parapertussis [TaxId:257311] [187960] (1 PDB entry)

8. Domain d2ojla_: 2ojl A: [166716]
   automated match to d2fa8a1

Details for d2ojla_

PDB Entry: 2ojl, 2.1 Å

PDB Description: crystal structure of q7waf1_borpa from bordetella parapertussis. northeast structural genomics target bpr68.

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ojla_:

Sequence; same for both SEQRES and ATOM records:

>d2ojla_ c.47.1.23 (A:) automated matches {Bordetella parapertussis [TaxId: 257311]}
hppriaiqyctqcqwllraawmaqellstfgadlgevalvpgtggvfrihyngaplwdre
vdggfpeakvlkqrvrdhl

Timeline for d2ojla_:

• d2ojla_ is new in SCOPe 2.01-stable
  
• d2ojla_ appears in SCOPe 2.02
  
• d2ojla_ appears in the current release, SCOPe 2.08