Lineage for d2oj4a_ (2oj4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719852Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2719853Protein automated matches [190464] (3 species)
    not a true protein
  7. 2719862Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2719888Domain d2oj4a_: 2oj4 A: [166715]
    automated match to d1ezta_

Details for d2oj4a_

PDB Entry: 2oj4 (more details), 2.3 Å

PDB Description: crystal structure of rgs3 rgs domain
PDB Compounds: (A:) Regulator of G-protein signaling 3

SCOPe Domain Sequences for d2oj4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oj4a_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seealkwgeslekllvhkyglavfqaflrtefseenlefwlacedfkkvksqskmaskak
kifaeyiaiqackevnldsytrehtkdnlqsvtrgcfdlaqkrifglmekdsyprflrsd
lyldlin

SCOPe Domain Coordinates for d2oj4a_:

Click to download the PDB-style file with coordinates for d2oj4a_.
(The format of our PDB-style files is described here.)

Timeline for d2oj4a_: