Lineage for d2oifg_ (2oif G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688569Species Barley (Hordeum vulgare) [TaxId:4513] [187359] (1 PDB entry)
  8. 2688576Domain d2oifg_: 2oif G: [166709]
    automated match to d1d8ua_
    complexed with cyn, hem, pgo

Details for d2oifg_

PDB Entry: 2oif (more details), 1.8 Å

PDB Description: the crystal structure of ferric cyanide bound barley hexacoordinate hemoglobin.
PDB Compounds: (G:) Non-legume hemoglobin

SCOPe Domain Sequences for d2oifg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oifg_ a.1.1.2 (G:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
vvfseekealvlkswaimkkdsanlglrfflkifeiapsarqmfpflrdsdvpletnpkl
kthavsvfvmtceaaaqlrkagkitvrettlkrlggthlkygvadghfevtrfalletik
ealpadmwgpemrnawgeaydqlvaaikqemkpa

SCOPe Domain Coordinates for d2oifg_:

Click to download the PDB-style file with coordinates for d2oifg_.
(The format of our PDB-style files is described here.)

Timeline for d2oifg_: