Lineage for d2oife_ (2oif E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978752Species Barley (Hordeum vulgare) [TaxId:4513] [187359] (1 PDB entry)
  8. 1978757Domain d2oife_: 2oif E: [166707]
    automated match to d1d8ua_
    complexed with cyn, hem, pgo

Details for d2oife_

PDB Entry: 2oif (more details), 1.8 Å

PDB Description: the crystal structure of ferric cyanide bound barley hexacoordinate hemoglobin.
PDB Compounds: (E:) Non-legume hemoglobin

SCOPe Domain Sequences for d2oife_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oife_ a.1.1.2 (E:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
vvfseekealvlkswaimkkdsanlglrfflkifeiapsarqmfpflrdsdvpletnpkl
kthavsvfvmtceaaaqlrkagkitvrettlkrlggthlkygvadghfevtrfalletik
ealpadmwgpemrnawgeaydqlvaaikqemkp

SCOPe Domain Coordinates for d2oife_:

Click to download the PDB-style file with coordinates for d2oife_.
(The format of our PDB-style files is described here.)

Timeline for d2oife_: