Lineage for d2oifc_ (2oif C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688569Species Barley (Hordeum vulgare) [TaxId:4513] [187359] (1 PDB entry)
  8. 2688572Domain d2oifc_: 2oif C: [166705]
    automated match to d1d8ua_
    complexed with cyn, hem, pgo

Details for d2oifc_

PDB Entry: 2oif (more details), 1.8 Å

PDB Description: the crystal structure of ferric cyanide bound barley hexacoordinate hemoglobin.
PDB Compounds: (C:) Non-legume hemoglobin

SCOPe Domain Sequences for d2oifc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oifc_ a.1.1.2 (C:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
vfseekealvlkswaimkkdsanlglrfflkifeiapsarqmfpflrdsdvpletnpklk
thavsvfvmtceaaaqlrkagkitvrettlkrlggthlkygvadghfevtrfalletike
alpadmwgpemrnawgeaydqlvaaikqemkp

SCOPe Domain Coordinates for d2oifc_:

Click to download the PDB-style file with coordinates for d2oifc_.
(The format of our PDB-style files is described here.)

Timeline for d2oifc_: