Lineage for d2oi9b_ (2oi9 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744463Domain d2oi9b_: 2oi9 B: [166701]
    automated match to d1i9ea_

Details for d2oi9b_

PDB Entry: 2oi9 (more details), 2.35 Å

PDB Description: Structure of the 2C/Ld/QL9 allogeneic complex
PDB Compounds: (B:) T cell receptor alpha chain

SCOPe Domain Sequences for d2oi9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oi9b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhrsdsavyfcavsgfasaltfgsgtkvivl

SCOPe Domain Coordinates for d2oi9b_:

Click to download the PDB-style file with coordinates for d2oi9b_.
(The format of our PDB-style files is described here.)

Timeline for d2oi9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2oi9c_