SCOPe 2.08: Domain d2oi9b_: 2oi9 B:

Lineage for d2oi9b_ (2oi9 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2oi9b_: 2oi9 B: [166701]
   automated match to d1i9ea_

Details for d2oi9b_

PDB Entry: 2oi9, 2.35 Å

PDB Description: Structure of the 2C/Ld/QL9 allogeneic complex

PDB Compounds: (B:) T cell receptor alpha chain

SCOPe Domain Sequences for d2oi9b_:

Sequence; same for both SEQRES and ATOM records:

>d2oi9b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhrsdsavyfcavsgfasaltfgsgtkvivl

Timeline for d2oi9b_:

• d2oi9b_ first appeared in SCOPe 2.01
  
• d2oi9b_ appears in SCOPe 2.07