SCOP 1.61: Domain d1bfru_: 1bfr U:

Lineage for d1bfru_ (1bfr U:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Bacterioferritin (cytochrome b1) [47244] (2 species)

7. Species Escherichia coli [TaxId:562] [47245] (2 PDB entries)

8. Domain d1bfru_: 1bfr U: [16670]

Details for d1bfru_

PDB Entry: 1bfr, 2.94 Å

PDB Description: iron storage and electron transport

SCOP Domain Sequences for d1bfru_:

Sequence; same for both SEQRES and ATOM records:

>d1bfru_ a.25.1.1 (U:) Bacterioferritin (cytochrome b1) {Escherichia coli}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

Timeline for d1bfru_:

• d1bfru_ first appeared (with stable ids) in SCOP 1.55
  
• d1bfru_ appears in SCOP 1.59
  
• d1bfru_ appears in SCOP 1.63
  
• d1bfru_ appears in the current release, SCOPe 2.08