SCOPe 2.04: Domain d2ogya_: 2ogy A:

Lineage for d2ogya_ (2ogy A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)

6. Protein automated matches [190620] (2 species)
   not a true protein

7. Species Moorella thermoacetica [TaxId:1525] [187652] (4 PDB entries)

8. Domain d2ogya_: 2ogy A: [166694]
   automated match to d1f6ya_
   complexed with c2f, ca; mutant

Details for d2ogya_

PDB Entry: 2ogy, 2.3 Å

PDB Description: asn199ala mutant of the 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.3 angstrom resolution

PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d2ogya_:

Sequence; same for both SEQRES and ATOM records:

>d2ogya_ c.1.21.2 (A:) automated matches {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
qqikmladpapktvlglsavsqncqnrplinrtflamamacgldaaiadacdealietaa
taeillnqtvycdsfvkmfktr

Timeline for d2ogya_:

• d2ogya_ first appeared in SCOPe 2.01
  
• d2ogya_ appears in SCOPe 2.03
  
• d2ogya_ appears in SCOPe 2.05
  
• d2ogya_ appears in the current release, SCOPe 2.08